PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_C1D4586B1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 307aa    MW: 33090.1 Da    PI: 8.2767
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_C1D4586B1.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-141462148
                           TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           +g+W +eEd  l  +v+++G+  +W + +r++g++R++k+c++rw++yl
  Traes_5BL_C1D4586B1.2 14 KGPWAAEEDAVLRAYVAEHGTAgNWIALPRKIGLNRCGKSCRLRWLNYL 62
                           79******************99*************************97 PP

2Myb_DNA-binding43.38.6e-1469111246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g +T eEd l+  + +  G++ W+tIa+ ++ gRt++++k++w++
  Traes_5BL_C1D4586B1.2  69 GGFTDEEDRLICSLYASIGSR-WSTIAAQLP-GRTDNDVKNYWNT 111
                            569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.559962IPR017930Myb domain
SuperFamilySSF466892.97E-2611109IPR009057Homeodomain-like
SMARTSM007171.1E-101364IPR001005SANT/Myb domain
PfamPF002499.1E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-231569IPR009057Homeodomain-like
CDDcd001672.86E-81662No hitNo description
PROSITE profilePS5129421.80663117IPR017930Myb domain
SMARTSM007177.7E-1267115IPR001005SANT/Myb domain
PfamPF002495.7E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2370117IPR009057Homeodomain-like
CDDcd001672.30E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWAAE EDAVLRAYVA EHGTAGNWIA LPRKIGLNRC GKSCRLRWLN  60
YLRPNIRHGG FTDEEDRLIC SLYASIGSRW STIAAQLPGR TDNDVKNYWN TKLKRRLLGG  120
GRRPIRYAQQ PRLLLMSPTG GAASTALERM QLSVQRRLVG LQDTPGLPFY GNLWPAQQSL  180
LSPAAGYSGF WSHIQTSTYP GRLNVQDHQH AWGSSGGGGT TPMSTSPTGE TAVGVGSSSS  240
TPAASSVTFD GDMEDEIEML LQQIGCLEEE DSRLLIGSEA GSAGSWSSCS TPGVDSVFQG  300
YVQGHGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0632601e-129BT063260.1 Zea mays full-length cDNA clone ZM_BFc0043P16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576555.21e-129PREDICTED: transcription factor RAX3-like
SwissprotQ9FKL29e-78MYB36_ARATH; Transcription factor MYB36
TrEMBLW5FHJ90.0W5FHJ9_WHEAT; Uncharacterized protein
STRINGMLOC_5098.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132652632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-71myb domain protein 36
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]